Recombinant Human APPBP1 protein (ab116199)

Overview

  • Product name
    Recombinant Human APPBP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAQLGKLLKEQKYDRQLRLWGDHGQEA LESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQ RSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVV ATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPD NALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYS ETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALN TTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRG TIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISE KELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYL MLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDD YVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQ TSATFQL
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 534
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab116199 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • 59 kDa
    • A 116A10.1
    • Amyloid beta precursor protein binding protein 1
    • Amyloid beta precursor protein binding protein 1 59kD
    • Amyloid beta precursor protein binding protein 1 59kDa
    • Amyloid beta precursor protein binding protein 1, 59 kDa
    • Amyloid beta precursor protein-binding protein 1
    • Amyloid protein binding protein 1
    • Amyloid protein-binding protein 1
    • APP BP1
    • APP-BP1
    • APPBP 1
    • APPBP1
    • HPP 1
    • HPP1
    • NAE 1
    • NAE1
    • NEDD8 activating enzyme E1 regulatory subunit
    • NEDD8 activating enzyme E1 subunit
    • NEDD8 activating enzyme E1 subunit 1
    • NEDD8-activating enzyme E1 regulatory subunit
    • Proto oncogene protein 1
    • Proto-oncogene protein 1
    • Protooncogene protein 1
    • ula 1
    • ULA1_HUMAN
    see all
  • Function
    Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Necessary for cell cycle progression through the S-M checkpoint. Overexpression of NAE1 causes apoptosis through deregulation of NEDD8 conjugation.
  • Tissue specificity
    Ubiquitous in fetal tissues. Expressed throughout the adult brain.
  • Pathway
    Protein modification; protein neddylation.
  • Sequence similarities
    Belongs to the ubiquitin-activating E1 family. ULA1 subfamily.
  • Cellular localization
    Cell membrane. Colocalizes with APP in lipid rafts.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116199.

References

ab116199 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up