Recombinant Human APPBP1 protein (ab116199)

Overview

  • Product name
    Recombinant Human APPBP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAQLGKLLKEQKYDRQLRLWGDHGQEA LESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQ RSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVV ATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPD NALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYS ETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALN TTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRG TIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISE KELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYL MLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDD YVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQ TSATFQL
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 534
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab116199 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • 59 kDa
    • A 116A10.1
    • Amyloid beta precursor protein binding protein 1
    • Amyloid beta precursor protein binding protein 1 59kD
    • Amyloid beta precursor protein binding protein 1 59kDa
    • Amyloid beta precursor protein binding protein 1, 59 kDa
    • Amyloid beta precursor protein-binding protein 1
    • Amyloid protein binding protein 1
    • Amyloid protein-binding protein 1
    • APP BP1
    • APP-BP1
    • APPBP 1
    • APPBP1
    • HPP 1
    • HPP1
    • NAE 1
    • NAE1
    • NEDD8 activating enzyme E1 regulatory subunit
    • NEDD8 activating enzyme E1 subunit
    • NEDD8 activating enzyme E1 subunit 1
    • NEDD8-activating enzyme E1 regulatory subunit
    • Proto oncogene protein 1
    • Proto-oncogene protein 1
    • Protooncogene protein 1
    • ula 1
    • ULA1_HUMAN
    see all
  • Function
    Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Necessary for cell cycle progression through the S-M checkpoint. Overexpression of NAE1 causes apoptosis through deregulation of NEDD8 conjugation.
  • Tissue specificity
    Ubiquitous in fetal tissues. Expressed throughout the adult brain.
  • Pathway
    Protein modification; protein neddylation.
  • Sequence similarities
    Belongs to the ubiquitin-activating E1 family. ULA1 subfamily.
  • Cellular localization
    Cell membrane. Colocalizes with APP in lipid rafts.
  • Information by UniProt

Recombinant Human APPBP1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab116199.

References for Recombinant Human APPBP1 protein (ab116199)

ab116199 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up