Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP07741
    • SpeciesHuman
    • SequenceMADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHL KATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWAS YSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEV LECVSLVELTSLKGREKLAPVPFFSLLQYE
    • Molecular weight20 kDa including tags
    • Amino acids1 to 180

Specifications

Our Abpromise guarantee covers the use of ab116469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab116469 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesAlthough stable 4°C for 4 weeks, ab116469 should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names
    • Adenine phosphoribosyltransferase
    • AMP
    • AMP diphosphorylase
    • AMP pyrophosphorylase
    • APRT
    • APT_HUMAN
    • DKFZp686D13177
    • MGC125856
    • MGC125857
    • MGC129961
    • Transphosphoribosidase
    see all
  • FunctionCatalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
  • PathwayPurine metabolism; AMP biosynthesis via salvage pathway; AMP from adenine: step 1/1.
  • Involvement in diseaseDefects in APRT are the cause of adenine phosphoribosyltransferase deficiency (APRTD) [MIM:102600]; also known as 2,8-dihydroxyadenine urolithiasis. An enzymatic deficiency that can lead to urolithiasis and renal failure. Patients have 2,8-dihydroxyadenine (DHA) urinary stones.
  • Sequence similaritiesBelongs to the purine/pyrimidine phosphoribosyltransferase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant Human APRT protein (ab116469)

ab116469 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"