Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHL KATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWAS YSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEV LECVSLVELTSLKGREKLAPVPFFSLLQYE
    • Molecular weight
      20 kDa including tags
    • Amino acids
      1 to 180

Specifications

Our Abpromise guarantee covers the use of ab116469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab116469 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Additional notes
    Although stable 4°C for 4 weeks, ab116469 should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names
    • Adenine phosphoribosyltransferase
    • AMP
    • AMP diphosphorylase
    • AMP pyrophosphorylase
    • APRT
    • APT_HUMAN
    • DKFZp686D13177
    • MGC125856
    • MGC125857
    • MGC129961
    • Transphosphoribosidase
    see all
  • Function
    Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
  • Pathway
    Purine metabolism; AMP biosynthesis via salvage pathway; AMP from adenine: step 1/1.
  • Involvement in disease
    Defects in APRT are the cause of adenine phosphoribosyltransferase deficiency (APRTD) [MIM:102600]; also known as 2,8-dihydroxyadenine urolithiasis. An enzymatic deficiency that can lead to urolithiasis and renal failure. Patients have 2,8-dihydroxyadenine (DHA) urinary stones.
  • Sequence similarities
    Belongs to the purine/pyrimidine phosphoribosyltransferase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References for Recombinant Human APRT protein (ab116469)

ab116469 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up