Recombinant Human Aquaporin 8 protein (ab114673)

Overview

  • Product nameRecombinant Human Aquaporin 8 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO94778
    • SpeciesHuman
    • SequenceMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSV IENGTDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLN LVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAG ALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSG GCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIRCFIGDGKTRL ILKAR
    • Molecular weight54 kDa including tags
    • Amino acids1 to 255

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AQP 8
    • AQP-8
    • AQP8
    • AQP8_HUMAN
    • Aquaporin 8
    • Aquaporin-8
    • Aquaporin8
    see all
  • FunctionForms a water-specific channel; mercury-sensitive. Not permeable to glycerol or urea.
  • Tissue specificityExpressed only in pancreas and colon.
  • Sequence similaritiesBelongs to the MIP/aquaporin (TC 1.A.8) family.
  • DomainAquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Aquaporin 8 protein images

  • SDS-PAGE analysis of ab114673 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Aquaporin 8 protein (ab114673)

ab114673 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"