Recombinant Human Aquaporin 8 protein (ab114673)

Overview

  • Product name
    Recombinant Human Aquaporin 8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSV IENGTDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLN LVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAG ALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSG GCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIRCFIGDGKTRL ILKAR
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 255

Specifications

Our Abpromise guarantee covers the use of ab114673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AQP 8
    • AQP-8
    • AQP8
    • AQP8_HUMAN
    • Aquaporin 8
    • Aquaporin-8
    • Aquaporin8
    see all
  • Function
    Forms a water-specific channel; mercury-sensitive. Not permeable to glycerol or urea.
  • Tissue specificity
    Expressed only in pancreas and colon.
  • Sequence similarities
    Belongs to the MIP/aquaporin (TC 1.A.8) family.
  • Domain
    Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human Aquaporin 8 protein images

  • SDS-PAGE analysis of ab114673 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Aquaporin 8 protein (ab114673)

ab114673 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up