Overview

  • Product name
    Recombinant Human ARA9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHPVWETIVCTMREGEIAQFLCDIKHVVLYPL VAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIF HMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAA KYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEV MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVL DDSRARGKPMELIIGKKFKLLDHCSSILNKYDDNVKAYFKRGKAHAAVWN AQEAQADFAKVLELDPALAPVVSRELRALEARIRQKDEEDKARFRGIFSH
    • Molecular weight
      40 kDa including tags
    • Amino acids
      1 to 330
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109934 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab109934 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names
    • AH receptor interacting protein
    • AH receptor-interacting protein
    • AIP
    • AIP_HUMAN
    • ARA 9
    • ARA9
    • Aryl hydrocarbon receptor interacting protein
    • Aryl-hydrocarbon receptor-interacting protein
    • fa03h10
    • FKBP 16
    • FKBP 37
    • FKBP16
    • FKBP37
    • HBV X associated protein
    • HBV X associated protein 2
    • HBV X-associated protein 2
    • HBVX associated protein
    • Immunophilin homolog ARA 9
    • Immunophilin homolog ARA9
    • SMTPHN
    • XAP 2
    • XAP-2
    • XAP2
    see all
  • Function
    May play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting.
    Cellular negative regulator of the hepatitis B virus (HBV) X protein.
  • Tissue specificity
    Widely expressed. Higher levels seen in the heart, placenta and skeletal muscle. Not expressed in the liver.
  • Involvement in disease
    Defects in AIP are a cause of familial isolated pituitary adenoma (FIPA) [MIM:102200].
    Defects in AIP are a cause of growth hormone-secreting pituitary adenoma (GHSPA) [MIM:102200]; also known as familial isolated somatotropinomas (FIS) or isolated familial somatotropinoma (IFS) or familial somatotrophinoma or acromegaly due to pituitary adenoma.
    Defects in AIP are a cause of ACTH-secreting pituitary adenoma (ASPA) [MIM:219090]; also known as pituitary Cushing disease. A pituary adenoma resulting in excessive production of adrenocorticotropic hormone. This leads to hypersecretion of cortisol by the adrenal glands and ACTH-dependent Cushing syndrome. Clinical manifestations of Cushing syndrome include facial and trunkal obesity, abdominal striae, muscular weakness, osteoporosis, arterial hypertension, diabetes.
    Defects in AIP are a cause of prolactin-secreting pituitary adenoma (PSPA) [MIM:600634]; also known as prolactinoma. Prolactin-secreting pituitary adenoma is the most common type of hormonally active pituitary adenoma.
  • Sequence similarities
    Contains 1 PPIase FKBP-type domain.
    Contains 2 TPR repeats.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab109934 at approximately 39.8 kDa (3µg).

References

ab109934 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109934.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up