Overview

  • Product nameRecombinant Human ARA9 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO00170
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHPVWETIVCTMREGEIAQFLCDIKHVVLYPL VAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIF HMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAA KYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEV MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVL DDSRARGKPMELIIGKKFKLLDHCSSILNKYDDNVKAYFKRGKAHAAVWN AQEAQADFAKVLELDPALAPVVSRELRALEARIRQKDEEDKARFRGIFSH
    • Molecular weight40 kDa including tags
    • Amino acids1 to 330
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109934 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109934 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names
    • AH receptor interacting protein
    • AH receptor-interacting protein
    • AIP
    • AIP_HUMAN
    • ARA 9
    • ARA9
    • Aryl hydrocarbon receptor interacting protein
    • Aryl-hydrocarbon receptor-interacting protein
    • fa03h10
    • FKBP 16
    • FKBP 37
    • FKBP16
    • FKBP37
    • HBV X associated protein
    • HBV X associated protein 2
    • HBV X-associated protein 2
    • HBVX associated protein
    • Immunophilin homolog ARA 9
    • Immunophilin homolog ARA9
    • SMTPHN
    • XAP 2
    • XAP-2
    • XAP2
    see all
  • FunctionMay play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting.
    Cellular negative regulator of the hepatitis B virus (HBV) X protein.
  • Tissue specificityWidely expressed. Higher levels seen in the heart, placenta and skeletal muscle. Not expressed in the liver.
  • Involvement in diseaseDefects in AIP are a cause of familial isolated pituitary adenoma (FIPA) [MIM:102200].
    Defects in AIP are a cause of growth hormone-secreting pituitary adenoma (GHSPA) [MIM:102200]; also known as familial isolated somatotropinomas (FIS) or isolated familial somatotropinoma (IFS) or familial somatotrophinoma or acromegaly due to pituitary adenoma.
    Defects in AIP are a cause of ACTH-secreting pituitary adenoma (ASPA) [MIM:219090]; also known as pituitary Cushing disease. A pituary adenoma resulting in excessive production of adrenocorticotropic hormone. This leads to hypersecretion of cortisol by the adrenal glands and ACTH-dependent Cushing syndrome. Clinical manifestations of Cushing syndrome include facial and trunkal obesity, abdominal striae, muscular weakness, osteoporosis, arterial hypertension, diabetes.
    Defects in AIP are a cause of prolactin-secreting pituitary adenoma (PSPA) [MIM:600634]; also known as prolactinoma. Prolactin-secreting pituitary adenoma is the most common type of hormonally active pituitary adenoma.
  • Sequence similaritiesContains 1 PPIase FKBP-type domain.
    Contains 2 TPR repeats.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human ARA9 protein images

  • 15% SDS-PAGE showing ab109934 at approximately 39.8 kDa (3µg).

References for Recombinant Human ARA9 protein (ab109934)

ab109934 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109934.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"