Overview

  • Product name
    Recombinant Human ARD1A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMNIRNARPEDLMNMQHCNLLCLPENYQMKY YFYHGLSWPQLSYIAEDE NGKIVGYVLAKMEEDPDDVPHGHITSLAVK RSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYS NTL NFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAI ENKVESKGNSPPSSGEACREEK GLAAEDSGGDSKDLSEVSETTESTDV KDSSEASDSAS
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 235
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113135 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.08% DTT, 10% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • Alpha N acetyltransferase 1A
    • ARD1
    • ARD1 homolog N acetyltransferase (S. cerevisiae)
    • ARD1 homolog A N acetyltransferase
    • ARD1 homolog A N acetyltransferase (S. cerevisiae)
    • ARD1A
    • DXS707
    • MGC71248
    • N acetyltransferase ARD1, human homolog of
    • N alpha acetyltransferase 10 NatA catalytic subunit
    • N terminal acetyltransferase complex ARD1 subunit homolog A
    • N(alpha) acetyltransferase 10 NatA catalytic subunit
    • N-alpha-acetyltransferase 10
    • N-terminal acetyltransferase complex ARD1 subunit homolog A
    • Naa10
    • NAA10_HUMAN
    • NatA catalytic subunit
    • TE2
    see all
  • Function
    In complex with NAA15, displays alpha (N-terminal) acetyltransferase activity. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the acetyltransferase family. ARD1 subfamily.
    Contains 1 N-acetyltransferase domain.
  • Post-translational
    modifications
    Cleaved by caspases during apoptosis.
  • Cellular localization
    Cytoplasm. Nucleus. According to PubMed:12464182 it is cytoplasmic. According to PubMed:15496142, it is nuclear and cytoplasmic. Also present in the free cytosolic and cytoskeleton-bound polysomes.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab113135.

References

ab113135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up