Overview

  • Product nameRecombinant Human ARD1A protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP41227
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMNIRNARPEDLMNMQHCNLLCLPENYQMKY YFYHGLSWPQLSYIAEDE NGKIVGYVLAKMEEDPDDVPHGHITSLAVK RSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYS NTL NFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAI ENKVESKGNSPPSSGEACREEK GLAAEDSGGDSKDLSEVSETTESTDV KDSSEASDSAS
    • Molecular weight29 kDa including tags
    • Amino acids1 to 235
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113135 was purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.08% DTT, 10% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • Alpha N acetyltransferase 1A
    • ARD1
    • ARD1 homolog N acetyltransferase (S. cerevisiae)
    • ARD1 homolog A N acetyltransferase
    • ARD1 homolog A N acetyltransferase (S. cerevisiae)
    • ARD1A
    • DXS707
    • MGC71248
    • N acetyltransferase ARD1, human homolog of
    • N alpha acetyltransferase 10 NatA catalytic subunit
    • N terminal acetyltransferase complex ARD1 subunit homolog A
    • N(alpha) acetyltransferase 10 NatA catalytic subunit
    • N-alpha-acetyltransferase 10
    • N-terminal acetyltransferase complex ARD1 subunit homolog A
    • Naa10
    • NAA10_HUMAN
    • NatA catalytic subunit
    • TE2
    see all
  • FunctionIn complex with NAA15, displays alpha (N-terminal) acetyltransferase activity. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the acetyltransferase family. ARD1 subfamily.
    Contains 1 N-acetyltransferase domain.
  • Post-translational
    modifications
    Cleaved by caspases during apoptosis.
  • Cellular localizationCytoplasm. Nucleus. According to PubMed:12464182 it is cytoplasmic. According to PubMed:15496142, it is nuclear and cytoplasmic. Also present in the free cytosolic and cytoskeleton-bound polysomes.
  • Information by UniProt

Recombinant Human ARD1A protein images

  • 15% SDS-PAGE analysis of 3 µg ab113135.

References for Recombinant Human ARD1A protein (ab113135)

ab113135 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"