Overview

  • Product name
    Recombinant Human ARF3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGNIFGNLLKSLIGKKEMRILMVGLDAAGK TTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH YFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDL PNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK K
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 181
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab113581 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • ADP ribosylation factor 3
    • ADP-ribosylation factor 3
    • ARF3
    • ARF3_HUMAN
    • small GTP binding protein
    see all
  • Function
    GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Arf family.
  • Cellular localization
    Golgi apparatus. Cytoplasm > perinuclear region.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab113581 (3µg).

References

ab113581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up