Overview

  • Product nameRecombinant Human ARF3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61204
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGNIFGNLLKSLIGKKEMRILMVGLDAAGK TTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH YFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDL PNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK K
    • Molecular weight23 kDa including tags
    • Amino acids1 to 181
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113581 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • ADP ribosylation factor 3
    • ADP-ribosylation factor 3
    • ARF3
    • ARF3_HUMAN
    • small GTP binding protein
    see all
  • FunctionGTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Cellular localizationGolgi apparatus. Cytoplasm > perinuclear region.
  • Information by UniProt

Recombinant Human ARF3 protein images

  • 15% SDS-PAGE showing ab113581 (3µg).

References for Recombinant Human ARF3 protein (ab113581)

ab113581 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"