Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP18085
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMGLTISSLFSRLFGKKQMRILMVGLD AAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRP LWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFAN KQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNE LSKR
    • Molecular weight23 kDa including tags
    • Amino acids1 to 180
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab102695 is purified by conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • ADP ribosylation factor 2
    • ADP ribosylation factor 4
    • ADP-ribosylation factor 4
    • ARF2
    • ARF4
    • ARF4_HUMAN
    see all
  • FunctionGTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Cellular localizationGolgi apparatus.
  • Information by UniProt

Recombinant Human ARF4 protein images

  • 15% SDS-PAGE analysis of ab102695 (3 µg).

References for Recombinant Human ARF4 protein (ab102695)

ab102695 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"