Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIG F NVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRE RIQE VADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQ SLRNRTW YVQATCATQGTGLYEGLDWLSNELSKR

Specifications

Our Abpromise guarantee covers the use of ab88553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88553 is purified by affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • ADP ribosylation factor 2
    • ADP ribosylation factor 4
    • ADP-ribosylation factor 4
    • ARF2
    • ARF4
    • ARF4_HUMAN
    see all
  • FunctionGTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Cellular localizationGolgi apparatus.
  • Information by UniProt

References for Recombinant Human ARF4 protein (ab88553)

ab88553 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"