Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGNHLTEMAPTASSFLPHFQALHVVVIGLD SAGKTSLLYRLKFKEFVQ SVPTKGFNTEKIRVPLGGSRGITFQVWDVG GQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRAS DNQ GVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGL QQGLERLYEMILKRKKAARGGK KRR
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 201
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113130 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • ADP ribosylation factor 4 like
    • ADP ribosylation factor like 4D
    • ADP ribosylation factor like 6
    • ADP ribosylation factor like protein 4D
    • ADP ribosylation factor like protein 4L
    • ADP-ribosylation factor-like protein 4D
    • ADP-ribosylation factor-like protein 4L
    • AR L6
    • ARF 4L
    • ARF4L
    • ARL 4D
    • ARL 6
    • ARL4D
    • ARL4D_HUMAN
    • ARL6
    see all
  • Function
    Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Arf family.
  • Cellular localization
    Nucleus > nucleolus. Cell membrane. Nucleus. Cytoplasm.
  • Information by UniProt

Recombinant Human ARF4L protein images

  • 15% SDS-PAGE analysis of 3 µg ab113130.

References for Recombinant Human ARF4L protein (ab113130)

ab113130 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up