Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGNHLTEMAPTASSFLPHFQALHVVVIGLD SAGKTSLLYRLKFKEFVQ SVPTKGFNTEKIRVPLGGSRGITFQVWDVG GQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRAS DNQ GVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGL QQGLERLYEMILKRKKAARGGK KRR
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 201
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113130 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • ADP ribosylation factor 4 like
    • ADP ribosylation factor like 4D
    • ADP ribosylation factor like 6
    • ADP ribosylation factor like protein 4D
    • ADP ribosylation factor like protein 4L
    • ADP-ribosylation factor-like protein 4D
    • ADP-ribosylation factor-like protein 4L
    • AR L6
    • ARF 4L
    • ARF4L
    • ARL 4D
    • ARL 6
    • ARL4D
    • ARL4D_HUMAN
    • ARL6
    see all
  • Function
    Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Arf family.
  • Cellular localization
    Nucleus > nucleolus. Cell membrane. Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab113130.

References

ab113130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up