Overview

  • Product name
    Recombinant Human ARF6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGKVLSKIFGNKEMRILMLGLDAAGKTTIL YKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTG TQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAM KPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 175
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab102025 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 0.2mM PMSF, pH 8.0

General Info

  • Alternative names
    • ADP ribosylation factor 6
    • ADP ribosylation factor protein 6
    • ADP-ribosylation factor 6
    • ARF6
    • ARF6_HUMAN
    • DKFZp564M0264
    • Small GTP binding protein
    • Small GTPase
    see all
  • Function
    GTP-binding protein involved in protein trafficking; regulates endocytic recycling and cytoskeleton remodeling. May modulate vesicle budding and uncoating within the Golgi apparatus. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in the regulation of dendritic spine development (By similarity). Contributes to the regulation of dendritic branching and filopodia extension.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Arf family.
  • Cellular localization
    Golgi apparatus. Cell membrane. Endosome membrane. Cell membrane. Cell projection > filopodium membrane. Recruited to the cell membrane in association with CYTH2 and ARL4C.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab102025 (3µg)

References

ab102025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up