Overview

  • Product nameRecombinant Human ARF6 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP62330
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGKVLSKIFGNKEMRILMLGLDAAGKTTIL YKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTG TQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAM KPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
    • Molecular weight22 kDa including tags
    • Amino acids1 to 175
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab102025 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 0.2mM PMSF, pH 8.0

General Info

  • Alternative names
    • ADP ribosylation factor 6
    • ADP ribosylation factor protein 6
    • ADP-ribosylation factor 6
    • ARF6
    • ARF6_HUMAN
    • DKFZp564M0264
    • Small GTP binding protein
    • Small GTPase
    see all
  • FunctionGTP-binding protein involved in protein trafficking; regulates endocytic recycling and cytoskeleton remodeling. May modulate vesicle budding and uncoating within the Golgi apparatus. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in the regulation of dendritic spine development (By similarity). Contributes to the regulation of dendritic branching and filopodia extension.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Cellular localizationGolgi apparatus. Cell membrane. Endosome membrane. Cell membrane. Cell projection > filopodium membrane. Recruited to the cell membrane in association with CYTH2 and ARL4C.
  • Information by UniProt

Recombinant Human ARF6 protein images

  • 15% SDS-PAGE analysis of ab102025 (3µg)

References for Recombinant Human ARF6 protein (ab102025)

ab102025 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"