Recombinant Human ARFGAP1 protein (ab163196)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHR GLGVHLSFVRSVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQ EKYNSRAAALFRDKVVALAEGREWSLESSPAQNWTPPQPRTLPSMVHRVS GQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFL NNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKFWGHKQQPEPA SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKGVGSKGWRDVTT FFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRK SPSSDSWTCADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVP PAVPTDDGWDNQNW
    • Amino acids
      1 to 414
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosylation factor 1 GTPase activating protein
    • ADP ribosylation factor GTPase activating protein 1
    • ADP-ribosylation factor 1 GTPase-activating protein
    • ADP-ribosylation factor GTPase-activating protein 1
    • ARF GAP 1
    • ARF1 directed GTPase activating protein
    • ARF1 GAP
    • ARF1-directed GTPase-activating protein
    • ARF1GAP
    • ARFG1_HUMAN
    • Arfgap1
    • GAP protein
    • HRIHFB2281
    see all
  • Function
    GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles, a prerequisite for vesicle's fusion with target compartment. Probably regulates ARF1-mediated transport via its interaction with the KDELR proteins and RNP24. Overexpression induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, as when ARF1 is deactivated. Its activity is stimulated by phosphoinosides and inhibited by phosphatidylcholine.
  • Sequence similarities
    Contains 1 Arf-GAP domain.
  • Domain
    The region downstream of Arf-GAP domain is essential to GAP activity in vivo. This region may be required for its targeting to Golgi membranes.
  • Cellular localization
    Cytoplasm. Golgi apparatus. Associates with the Golgi complex.
  • Information by UniProt

Images

  • ab163196 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up