Recombinant Human ARFIP1 protein (ab162118)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITS HGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAG GQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRG SRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAF ADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTI EDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAH KEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQ TLKQFHIKLKTPGVDAPSWLEEQ
    • Amino acids
      1 to 373
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosylation factor interacting protein 1
    • ADP-ribosylation factor-interacting protein 1
    • Arfaptin
    • Arfaptin-1
    • ARFIP 1
    • Arfip1
    • ARFP1_HUMAN
    • HSU52521
    • MGC117369
    see all
  • Function
    Putative target protein of ADP-ribosylation factor.
  • Tissue specificity
    Ubiquitously expressed. Higher levels in liver, pancreas, placenta, skeletal muscle and heart.
  • Sequence similarities
    Contains 1 AH domain.
  • Information by UniProt

Images

  • ab162118 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162118 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up