Recombinant Human ARFIP1 protein (ab187475)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAQESPKNSAAEIPVTSNGEVDDSREH SFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGGQRTQTKSG PVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELE AQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLE LHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQ YESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRN DVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKL KTPGVDAPSWLEEQ
    • Molecular weight
      41 kDa including tags
    • Amino acids
      1 to 341
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_055262.

Specifications

Our Abpromise guarantee covers the use of ab187475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab187475 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 30% Glycerol, 69% PBS, 0.02% DTT

General Info

  • Alternative names
    • ADP ribosylation factor interacting protein 1
    • ADP-ribosylation factor-interacting protein 1
    • Arfaptin
    • Arfaptin-1
    • ARFIP 1
    • Arfip1
    • ARFP1_HUMAN
    • HSU52521
    • MGC117369
    see all
  • Function
    Putative target protein of ADP-ribosylation factor.
  • Tissue specificity
    Ubiquitously expressed. Higher levels in liver, pancreas, placenta, skeletal muscle and heart.
  • Sequence similarities
    Contains 1 AH domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab187475.

References

ab187475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up