Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMVHSVAVIGAPFSQGQKRKGVEHGPAAIRE AGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAE VVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTP LTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISASIVYIGLRDVD PPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDI DAFDPTLAPATFTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLA TSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARV RI
    • Molecular weight
      38 kDa including tags
    • Amino acids
      23 to 354
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab97349 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • ARG2
    • ARGI2_HUMAN
    • Arginase II mitochondrial
    • Arginase type II
    • Arginase-2
    • arginase-2, mitochondrial
    • Kidney arginase
    • Kidney type arginase
    • Kidney-type arginase
    • L arginine amidinohydrolase
    • L arginine ureahydrolase
    • mitochondrial
    • Non hepatic arginase
    • Non-hepatic arginase
    • Nonhepatic arginase
    • Type II arginase
    see all
  • Function
    May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase. Since NO synthase is found in the penile corpus cavernosum smooth muscle, the clitoral corpus cavernosum and the vagina, arginase II plays a role in both male and female sexual arousal. It is therefore a potential target for the treatment of male and female sexual arousal disorders.
  • Tissue specificity
    Expressed most strongly in kidney and prostate, much less strongly in the brain, skeletal muscle, placenta, lung, mammary gland, macrophage, uterus, testis and gut, but apparently not in the liver, heart and pancreas.
  • Pathway
    Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
  • Sequence similarities
    Belongs to the arginase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human Arg2 protein images

  • 15% SDS-PAGE showing ab97349 at approximately 38.3kDa (3µg).

References for Recombinant Human Arg2 protein (ab97349)

ab97349 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up