Recombinant Human Argininosuccinate Lyase protein (ab113605)

Overview

  • Product nameRecombinant Human Argininosuccinate Lyase protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP04424
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASESGKLWGGRFVGAVDPIMEKFNASIAY DRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFK LNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCS TLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVAL TRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSM DATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKE AVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRK GMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDY GHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
    • Molecular weight54 kDa including tags
    • Amino acids1 to 464
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab113605 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.04% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Argininosuccinase
    • Argininosuccinate lyase
    • Arginosuccinase
    • ARLY_HUMAN
    • ASAL
    • ASL
    • EC 4.3.2.1
    see all
  • PathwayAmino-acid biosynthesis; L-arginine biosynthesis; L-arginine from L-ornithine and carbamoyl phosphate: step 3/3.
    Nitrogen metabolism; urea cycle; L-arginine and fumarate from (N(omega)-L-arginino)succinate: step 1/1.
  • Involvement in diseaseDefects in ASL are the cause of arginosuccinicaciduria (ARGINSA) [MIM:207900]. Arginosuccinicaciduria is an autosomal recessive disorder of the urea cycle. The disease is characterized by mental and physical retardation, liver enlargement, skin lesions, dry and brittle hair showing trichorrhexis nodosa microscopically and fluorescing red, convulsions, and episodic unconsciousness.
  • Sequence similaritiesBelongs to the lyase 1 family. Argininosuccinate lyase subfamily.
  • Post-translational
    modifications
    Acetylation modifies enzyme activity in response to alterations of extracellular nutrient availability. Acetylation increased with trichostin A (TSA) or with nicotinamide (NAM). Glucose increases acetylation by about a factor of 3 with decreasing enzyme activity. Acetylation on Lys-288 is decreased on the addition of extra amino acids resulting in activation of enzyme activity.
  • Information by UniProt

Recombinant Human Argininosuccinate Lyase protein images

  • 15% SDS-PAGE showing ab113605 (3 µg) at approximately 53.8 kDa.

References for Recombinant Human Argininosuccinate Lyase protein (ab113605)

ab113605 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"