Recombinant Human Arginyl tRNA synthetase protein (ab114873)

Overview

  • Product name
    Recombinant Human Arginyl tRNA synthetase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLK LKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPL LVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNEC IEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSS PNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIA HLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK NPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFE DRGFVQVDDGRKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEK ADMIIYVVDNGQSVHFQTIFAAAQMIGWYDPKVTRVFHAGFGVVLGEDKK KFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAY GCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANI DEEMLQKAARETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY IYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEAVAAVMAKGFD ILGIKPVQRM
    • Molecular weight
      99 kDa including tags
    • Amino acids
      1 to 660

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114873 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610011N19Rik
    • 2610037E21Rik
    • AL033339
    • Arginine tRNA ligase
    • Arginine tRNA ligase 1, cytoplasmic
    • Arginine--tRNA ligase
    • Arginyl tRNA synthetase 1
    • Arginyl tRNA synthetase cytoplasmic
    • Arginyl tRNA synthetase, cytoplasmic
    • Arginyl-tRNA synthetase, cytoplasmic
    • ArgRS
    • AW985894
    • DALRD 1
    • DALRD1
    • EC 6.1.1.19
    • MGC8641
    • MGC86730
    • RARS
    • SYRC_HUMAN
    • wu:fa96g09
    • zgc:56050
    • zgc:86730
    see all
  • Function
    Forms part of a macromolecular complex that catalyzes the attachment of specific amino acids to cognate tRNAs during protein synthesis. Modulates the secretion of AIMP1 and may be involved in generation of the inflammatory cytokine EMAP2 from AIMP1.
  • Sequence similarities
    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Domain
    The N-terminus (AA 1-72) has two regions predicted to be alpha-helical that might be involved in the multisynthetase complex assembly.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114873 at approximately 98.71kDa.
    Stained with Coomassie Blue.

References

ab114873 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114873.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up