Recombinant Human ARHGAP1 protein (ab116988)

Overview

  • Product name
    Recombinant Human ARHGAP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTN TNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      340 to 439

Specifications

Our Abpromise guarantee covers the use of ab116988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ARHGAP 1
    • Arhgap1
    • CDC42 GTPase activating protein
    • Cdc42 GTPase-activating protein
    • CDC42GAP
    • GTPase activating protein rhoOGAP
    • GTPase-activating protein rhoOGAP
    • GTPase-activating protein, Rho, 1
    • OTTHUMP00000233485
    • OTTHUMP00000233486
    • p50 RhoGAP
    • p50-RhoGAP
    • p50rhoGAP
    • RHG01_HUMAN
    • Rho GTPase activating protein 1
    • Rho GTPase-activating protein 1
    • Rho related small GTPase protein activator
    • Rho type GTPase activating protein 1
    • Rho-related small GTPase protein activator
    • Rho-type GTPase-activating protein 1
    • RHOGAP
    • RHOGAP1
    see all
  • Function
    GTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively inactive GDP-bound state. Cdc42 seems to be the preferred substrate.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 CRAL-TRIO domain.
    Contains 1 Rho-GAP domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116988 at approx. 36.63kDa. Stained with Coomassie Blue.

References

ab116988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up