Recombinant Human ARHGAP1 protein (ab116988)

Overview

  • Product nameRecombinant Human ARHGAP1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ07960
    • SpeciesHuman
    • SequenceGFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTN TNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL
    • Molecular weight37 kDa including tags
    • Amino acids340 to 439

Specifications

Our Abpromise guarantee covers the use of ab116988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • ARHGAP 1
    • Arhgap1
    • CDC42 GTPase activating protein
    • Cdc42 GTPase-activating protein
    • CDC42GAP
    • GTPase activating protein rhoOGAP
    • GTPase-activating protein rhoOGAP
    • GTPase-activating protein, Rho, 1
    • OTTHUMP00000233485
    • OTTHUMP00000233486
    • p50 RhoGAP
    • p50-RhoGAP
    • p50rhoGAP
    • RHG01_HUMAN
    • Rho GTPase activating protein 1
    • Rho GTPase-activating protein 1
    • Rho related small GTPase protein activator
    • Rho type GTPase activating protein 1
    • Rho-related small GTPase protein activator
    • Rho-type GTPase-activating protein 1
    • RHOGAP
    • RHOGAP1
    see all
  • FunctionGTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively inactive GDP-bound state. Cdc42 seems to be the preferred substrate.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesContains 1 CRAL-TRIO domain.
    Contains 1 Rho-GAP domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human ARHGAP1 protein images

  • 12.5% SDS-PAGE showing ab116988 at approx. 36.63kDa. Stained with Coomassie Blue.

References for Recombinant Human ARHGAP1 protein (ab116988)

ab116988 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"