Recombinant Human ARHGAP32 protein (ab160634)

Overview

  • Product name
    Recombinant Human ARHGAP32 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPPKVLSTWWRGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHG KLITFLRTFMKSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQ SCTAFIERYGIVDGIYRLSGVASNIQRLRHEFDSEHVPDLTKEPYVQDIH SVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLP PPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACF SGTAAFMEVRIQSVVVEFILNHVDVLLPHFSARTELIVPFPLRLLRKQFT PPLLGPMSPLNPLVQITVCISI
    • Amino acids
      1 to 322
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain-specific Rho GTPase-activating protein
    • GAB associated CDC42
    • GAB-associated Cdc42/Rac GTPase-activating protein
    • GC-GAP
    • GRIT
    • GTPase activating protein for Cdc42 and Rac1
    • GTPase regulator interacting with TrkA
    • KIAA0712,
    • p200RhoGAP
    • p250GAP
    • PX-RICS
    • rac GTPase activating protein
    • Rho GTPase activating protein 32
    • Rho GTPase-activating protein 32
    • Rho-type GTPase-activating protein 32
    • Rho/Cdc42/Rac GTPase-activating protein RICS
    • RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling
    • RICS
    see all
  • Relevance
    ARHGAP32 is a neuron-associated GTPase-activating protein that may regulate dendritic spine morphology and strength by modulating Rho GTPase
  • Cellular localization
    Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection, dendritic spine By similarity. Cytoplasm, cell cortex. Endosome membrane By similarity. Golgi apparatus membrane By similarity. Endoplasmic reticulum membrane By similarity. Membrane.

Images

  • ab160634 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up