Recombinant Human ARHGDIG protein (ab117023)

Overview

  • Product nameRecombinant Human ARHGDIG protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99819
    • SpeciesHuman
    • SequenceMLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRA PGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLS EQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCL HHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVS LFTDDDRTHHLSWEWGLCICQDWKD
    • Molecular weight51 kDa including tags
    • Amino acids1 to 225

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Arhgdig
    • GDIR3_HUMAN
    • OTTHUMP00000067353
    • OTTHUMP00000194914
    • Rho GDI 3
    • Rho GDI gamma
    • Rho GDP dissociation inhibitor (GDI) gamma
    • Rho GDP dissociation inhibitor 3
    • Rho GDP dissociation inhibitor gamma
    • Rho GDP-dissociation inhibitor 3
    • Rho-GDI gamma
    • RHOGDI 3
    • RhoGDI gamma
    • RHOGDI3
    see all
  • FunctionInhibits GDP/GTP exchange reaction of RhoB. Interacts specifically with the GDP- and GTP-bound forms of post-translationally processed Rhob and Rhog proteins, both of which show a growth-regulated expression in mammalian cells. Stimulates the release of the GDP-bound but not the GTP-bound RhoB protein. Also inhibits the GDP/GTP exchange of RhoB but shows less ability to inhibit the dissociation of prebound GTP.
  • Tissue specificityPrimarily expressed in pancreas and brain.
  • Sequence similaritiesBelongs to the Rho GDI family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human ARHGDIG protein images

  • 12.5% SDS-PAGE showing ab117023 at approximately 50.86 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human ARHGDIG protein (ab117023)

ab117023 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"