Recombinant Human ARHGEF3 protein (ab162353)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDIL APRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQ GEEDLIEDLK
    • Amino acids
      33 to 142
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1200004I24Rik
    • 59.8 kDA protein
    • 9830169H03Rik
    • ARHGEF 3
    • C76747
    • DKFZP434F2429
    • Exchange factor found in platelets and leukemic and neuronal tissues
    • Exchange factor found in platelets and leukemic and neuronal tissues XPLN
    • FLJ98126
    • GEF 3
    • GEF3
    • MGC118905
    • Rho guanine nucleotide exchange factor (GEF) 3
    • Rho guanine nucleotide exchange factor 3
    • RhoGEF protein
    • STA 3
    • STA3
    • XPLN
    see all
  • Relevance
    Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. ARHGEF3 encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in ARHGEF3 plays a role in the determination of bone mineral density (BMD), suggesting a role in postmenopausal osteoporosis.
  • Cellular localization
    Cytoplasmic

Images

  • ab162353 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162353 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up