Recombinant Human ARHGEF39 protein (ab164686)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELSCPGSRCPVQEQRARWERKRACTARELLETERRYQEQLGLVATYFLG ILKAKGTLRPPERQALFGSWELIYGASQELLPYLEGGCWGQGLEGFCRHL ELYNQFAANSERSQTTLQEQLKKNKGFRRFVRLQEGRPEFGGLQLQDLLP LPLQRLQQYENLVVALAENTGPNSPDHQQLTRAARLISETAQRVHTIGQK QKNDQHLRRVQALLSGRQAKGLTSGRWFLRQGWLLVVPPHGEPRPRMFFL FTDVLLMAKPRPPLHLLRSGTFACKALYPMAQCHLSRVFGHSGGPCGGLL SLSFPHEKLLLMSTDQEELSRWYHSLTWAISSQKN
    • Amino acids
      1 to 335
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARG39_HUMAN
    • Arhgef39
    • C9orf100
    • Chromosome 9 open reading frame 100
    • FLJ14642
    • Hypothetical protein LOC84904
    • MGC44886
    • Rho guanine nucleotide exchange factor (GEF) 39
    • Rho guanine nucleotide exchange factor 39
    • RP11 331F9.7
    • RP11-331F9.7
    • Vav like protein C9orf100
    see all
  • Function
    Promotes cell proliferation.
  • Tissue specificity
    Strongly expressed in hepatocellular carcinoma (HCC) compared with their non-cancerous counterparts.
  • Sequence similarities
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab164686 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up