Recombinant Human ARHGEF4 protein (ab162351)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGE APSQPRGIPHRSPVSVDDLWLEKTQRKKLQKQAHVERRLHIGAVHKDGVK
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APC stimulated guanine nucleotide exchange factor
    • APC stimulated guanine nucleotide exchange factor 1
    • ARHGEF 4
    • Asef
    • ASEF1
    • GEF
    • GEF 4
    • GEF4
    • KIAA1112
    • Rho guanine nucleotide exchange factor (GEF) 4
    • Rho guanine nucleotide exchange factor 4
    • STM 6
    • STM6
    see all
  • Relevance
    This protein may form complexes with G proteins and stimulate Rho-dependent signals, and is similar to rat collybistin protein. Rho GTPases play a fundamental role in numerous cellular processes, which are initiated by extracellular stimuli that work through G protein coupled receptors. Alternative splicing of this gene generates two transcript variants which encode different isoforms.
  • Cellular localization
    Cytoplasm. Cell projection; ruffle membrane; Peripheral membrane protein; Cytoplasmic side Probable. Note: Associated with membrane ruffles

Images

  • ab162351 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162351 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up