Recombinant Human ARHGEF6 protein (ab160498)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKAT EDQLSERPCGRSSSLSAANTSQTNPQGAVSSTVSGLQRQSKTVEMTENGS HQLIVKARFNFKQTN
    • Amino acids
      61 to 175
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha Pix
    • Alpha-Pix
    • ARHG6_HUMAN
    • ARHGEF6
    • COOL 2
    • COOL-2
    • COOL2
    • Mental retardation, X linked 46
    • MRX46
    • PAK interacting exchange factor alpha
    • PAK-interacting exchange factor alpha
    • PIXA
    • Rac/Cdc42 guanine exchange factor (GEF) 6
    • Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
    • Rac/Cdc42 guanine nucleotide exchange factor 6
    • Rho guanine nucleotide exchange factor 6
    see all
  • Function
    Acts as a RAC1 guanine nucleotide exchange factor (GEF).
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in ARHGEF6 are the cause of mental retardation X-linked type 46 (MRX46) [MIM:300436]. Mental retardation is a mental disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
  • Sequence similarities
    Contains 1 CH (calponin-homology) domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Information by UniProt

Images

  • ab160498 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up