Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKK
    • Amino acids
      371 to 470
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMP activated protein kinase family member 5
    • AMPK related protein kinase 5
    • AMPK-related protein kinase 5
    • NUAK family SNF1 like kinase
    • NUAK family SNF1-like kinase 1
    • Nuak1
    • NUAK1_HUMAN
    • Omphalocele kinase 1
    • Probable serine/threonine protein kinase KIAA0537
    see all
  • Function
    Involved in tolerance to glucose starvation. Phosphorylates ATM. Suppresses Fas-induced apoptosis by phosphorylation of CASP6, thus suppressing the activation of the caspase and the subsequent cleavage of CFLAR.
  • Tissue specificity
    Expressed at high levels in heart and brain, and at lower levels in skeletal muscle, kidney, ovary, placenta, lung and liver.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Ubiquitinated with 'Lys-29'- and 'Lys-33'-linked polyubiquitins which appear to impede LKB1-mediated phosphorylation. Deubiquitinated by USP9X.
  • Information by UniProt

Images

  • ab160701 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up