Overview

  • Product nameRecombinant Human ARL1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP40616
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGGFFSSIFSSLFGTREMRILILGLDGAGK TTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRC YYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDM EQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR Q
    • Molecular weight23 kDa including tags
    • Amino acids1 to 181
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99261 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • ADP ribosylation factor like 1
    • ADP-ribosylation factor-like protein 1
    • ARFL1
    • Arl1
    • ARL1_HUMAN
    see all
  • FunctionGTP-binding protein that has very low efficiency as allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Can activate phospholipase D with very low efficiency. Important for normal function of the Golgi apparatus.
  • Tissue specificityDetected in heart, liver, lung and liver (at protein level). Detected in fetal heart, lung, liver and kidney. Detected in adult heart, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt

Recombinant Human ARL1 protein images

  • 15% SDS-PAGE showing ab99261 at approximately 22.5kDa (3µg).

References for Recombinant Human ARL1 protein (ab99261)

ab99261 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"