Recombinant Human ARL13B protein (ab165871)

Overview

  • Product name
    Recombinant Human ARL13B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPP PPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS
    • Amino acids
      329 to 428
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosylation factor like 13B
    • ADP ribosylation factor like 2 like 1
    • ADP-ribosylation factor-like protein 13B
    • ADP-ribosylation factor-like protein 2-like 1
    • AR13B_HUMAN
    • arl13b
    • ARL2-like protein 1
    • ARL2L1
    • JBTS8
    see all
  • Involvement in disease
    Defects in ARL13B are the cause of Joubert syndrome type 8 (JBTS8) [MIM:612291]. JBTS is an autosomal recessive disorder presenting with cerebellar ataxia, oculomotor apraxia, hypotonia, neonatal breathing abnormalities and psychomotor delay. Neuroradiologically, it is characterized by cerebellar vermis hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable features include retinal dystrophy and renal disease.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Arf family.
  • Information by UniProt

Images

  • ab165871 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165871 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up