Overview

  • Product nameRecombinant Human ARL15 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NXU5
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSDLRITEAFLYMDYLCFRALCCKGPPPAR PEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNV KELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHP QLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDM DALKDSFSQLINLLEEKDHEAVRM
    • Molecular weight25 kDa including tags
    • Amino acids1 to 204
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab113118 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • A430036I03
    • ADP ribosylation factor like 15
    • ADP-ribosylation factor-like protein 15
    • ADP-ribosylation factor-related protein 2
    • ARF-related protein 2
    • ARFRP2
    • ARL15
    • ARL15_HUMAN
    • C230032K13Rik
    • FLJ20051
    • rCG_44824
    see all
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Information by UniProt

Recombinant Human ARL15 protein images

  • 15% SDS-PAGE analysis of 3 µg ab113118.

References for Recombinant Human ARL15 protein (ab113118)

ab113118 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"