Recombinant Human ARL2BP protein (ab101067)

Overview

  • Product nameRecombinant Human ARL2BP protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y2Y0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDALEGESFALSFSSASDAEFDAVVGYLED IIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQ LLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRA EKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
    • Molecular weight21 kDa including tags
    • Amino acids1 to 163
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101067 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 7.5

General Info

  • Alternative names
    • ADP ribosylation factor like 2 binding protein
    • ADP-ribosylation factor-like protein 2-binding protein
    • AR2BP_HUMAN
    • Arf like 2 binding protein BART1
    • ARF-like 2-binding protein
    • ARL2 binding protein
    • Arl2bp
    • ARL2BP protein
    • BART
    • BART1
    • Binder of ARF2 protein 1
    • Binder of Arl Two
    • Binder of Arl2
    • Retinitis pigmentosa 66 (autosomal recessive)
    • RP66
    see all
  • FunctionTogether with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the ARL2BP family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm. Mitochondrion intermembrane space. Cytoplasm > cytoskeleton > centrosome. Nucleus. Cytoplasm > cytoskeleton > spindle. The complex formed with ARL2BP, ARL2 and SLC25A4 is expressed in mitochondria (By similarity). Detected in the midbody matrix. Not detected in the Golgi, nucleus and on the mitotic spindle. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules.
  • Information by UniProt

Recombinant Human ARL2BP protein images

  • 15% SDS-PAGE analysis of ab101067 (3 µg).

References for Recombinant Human ARL2BP protein (ab101067)

ab101067 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101067.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"