Overview

  • Product nameRecombinant Human ARL3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP36405
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMGLLSILRKLKSAPDQEVRILLLGLD NAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRP YWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFAN KQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKN VNAKKK
    • Molecular weight23 kDa including tags
    • Amino acids1 to 182
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113590 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

General Info

  • Alternative names
    • ADP ribosylation factor like 3
    • ADP-ribosylation factor-like protein 3
    • Arf like 3
    • Arf like protein 3
    • ARFL3
    • ARL3
    • ARL3_HUMAN
    see all
  • FunctionSmall GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Requires assistance from GTPase-activating proteins (GAPs) like RP2 and PDE6D, in order to cycle between inactive GDP-bound and active GTP-bound forms. Required for normal cytokinesis and cilia signaling.
  • Tissue specificityExpressed in the retina. Strongly expressed in connecting cilium, the myoid region of the inner segments (IS) and in cone photoreceptors (at protein level).
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Cellular localizationGolgi apparatus membrane. Cytoplasm > cytoskeleton > spindle. Nucleus. Cytoplasm > cytoskeleton > centrosome. Cytoplasm. Cell projection > cilium. Detected predominantly in the photoreceptor connecting cilium. Present on the mitotic spindle. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules.
  • Information by UniProt

Recombinant Human ARL3 protein images

  • 15% SDS-PAGE analysis of ab113590 (3µg)

References for Recombinant Human ARL3 protein (ab113590)

ab113590 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"