Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP40617
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGNGLSDQTSILSNLPSFQSFHIVILGLDC AGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQE KLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVL IVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLE KLHDMIIKRRKMLRQQKKKR
    • Molecular weight25 kDa including tags
    • Amino acids1 to 200
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109841 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ADP ribosylation factor like 4
    • ADP ribosylation factor like 4A
    • ADP-ribosylation factor-like protein 4A
    • ARL 4
    • ARL4
    • Arl4a
    • ARL4A_HUMAN
    see all
  • FunctionSmall GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Post-translational
    modifications
    Myristoylated.
  • Cellular localizationCell membrane. Cytoplasm. Nucleus > nucleolus. Localization in the nucleolus is dependent by nucleotide binding.
  • Information by UniProt

Recombinant Human ARL4 protein images

  • 15% SDS-PAGE showing ab109841 at approximately 24.7kDa (3µg).

References for Recombinant Human ARL4 protein (ab109841)

ab109841 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"