Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFMGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTT VLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPL WKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANK QDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDM IIKRRKMLRQQKKKR
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 200
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169882 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris-HCl buffer
    Note: Contains, NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • ADP ribosylation factor like 4
    • ADP ribosylation factor like 4A
    • ADP ribosylation factor like GTPase 4A
    • ADP-ribosylation factor-like protein 4A
    • ARL 4
    • ARL4
    • Arl4a
    • ARL4A_HUMAN
    see all
  • Function
    Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Arf family.
  • Post-translational
    modifications
    Myristoylated.
  • Cellular localization
    Cell membrane. Cytoplasm. Nucleus > nucleolus. Localization in the nucleolus is dependent by nucleotide binding.
  • Information by UniProt

References

ab169882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up