Overview

  • Product name
    Recombinant Human ARL4C protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTE KIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDR LEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELI PATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR
    • Amino acids
      1 to 192
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosylation factor like 4C
    • ADP ribosylation factor like 7
    • ADP-ribosylation factor-like protein 4C
    • ADP-ribosylation factor-like protein 7
    • ADP-ribosylation factor-like protein LAK
    • Arl4c
    • ARL4C_HUMAN
    • ARL7
    • LAK
    see all
  • Function
    Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. May be involved in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in the GDP-bound form. Regulates the microtubule-dependent intracellular vesicular transport from early endosome to recycling endosome process.
  • Tissue specificity
    Expressed in several tumor cell lines (at protein level). Expressed in lung, brain, leukocytes and placenta.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Arf family.
  • Cellular localization
    Cell projection > filopodium. Cell membrane. Cytoplasm.
  • Information by UniProt

Images

  • ab160832 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up