Overview

  • Product name
    Recombinant Human ARL5A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMGILFTRIWRLFNHQEHKVIIVGLDN AGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSS WNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANK QDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRL KIR
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 179
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101943 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 0.2mM PMSF, pH 8.0

General Info

  • Alternative names
    • ADP ribosylation factor like 5
    • ADP ribosylation factor like 5A
    • ADP ribosylation factor like protein 5
    • ADP ribosylation factor like protein 5A
    • ARFLP 5
    • ARFLP5
    • ARL 5
    • ARL 5A
    • ARL5
    see all
  • Relevance
    ARL5A lacks ADP ribosylation enhancing activity.The protein encoded by this gene belongs to the ARF family of GTP binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
  • Cellular localization
    Intracellular

Recombinant Human ARL5A protein images

  • 15% SDS-PAGE analysis of 3µg ab101943.

References for Recombinant Human ARL5A protein (ab101943)

ab101943 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up