Overview

  • Product name
    Recombinant Human ARL5B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGLIFAKLWSLFCNQEHKVIIVGLDNAGKT TILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTY YSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMK GCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 299
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113159 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.04% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA

General Info

  • Alternative names
    • ADP ribosylation factor like 5B
    • ADP ribosylation factor like 8
    • ADP ribosylation like factor 8
    • ADP-ribosylation factor-like protein 5B
    • ADP-ribosylation factor-like protein 8
    • Arl5b
    • ARL5B_HUMAN
    • ARL8
    • OTTHUMP00000019260
    see all
  • Function
    Binds and exchanges GTP and GDP.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Arf family.
  • Information by UniProt

Images

  • ab113159 at 3 µg analysed by 15% SDS PAGE.

References

ab113159 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up