Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96KC2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGLIFAKLWSLFCNQEHKVIIVGLDNAGKT TILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTY YSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMK GCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR
    • Molecular weight23 kDa including tags
    • Amino acids1 to 299
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113159 was purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.04% DTT, 30% Glycerol, 0.58% Sodium chloride, 0.03% EDTA

General Info

  • Alternative names
    • ADP ribosylation factor like 5B
    • ADP ribosylation factor like 8
    • ADP ribosylation like factor 8
    • ADP-ribosylation factor-like protein 5B
    • ADP-ribosylation factor-like protein 8
    • Arl5b
    • ARL5B_HUMAN
    • ARL8
    • OTTHUMP00000019260
    see all
  • FunctionBinds and exchanges GTP and GDP.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Information by UniProt

Recombinant Human ARL5B protein images

  • ab113159 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human ARL5B protein (ab113159)

ab113159 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"