Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGS NVEEIVVK NTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRER LAITKEELYRMLAHEDLR KAAVLIFANKQDMKGCMTAAEISKYLTLSS IKDHPWHIQSCCALTGEGLCQGLEWMTS RIGVR

Specifications

Our Abpromise guarantee covers the use of ab88400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88400 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • ADP ribosylation factor like 5B
    • ADP ribosylation factor like 8
    • ADP ribosylation like factor 8
    • ADP-ribosylation factor-like protein 5B
    • ADP-ribosylation factor-like protein 8
    • Arl5b
    • ARL5B_HUMAN
    • ARL8
    • OTTHUMP00000019260
    see all
  • FunctionBinds and exchanges GTP and GDP.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Arf family.
  • Information by UniProt

References for Recombinant Human ARL5B protein (ab88400)

ab88400 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"