Recombinant Human ARL6IP2 protein (ab163808)

Overview

  • Product name
    Recombinant Human ARL6IP2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFT EYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQ NQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFK RELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHP KSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDL KEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYA ARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYV KYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKAGLT DQVSHHARLKTD
    • Amino acids
      1 to 412
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosylation factor like 6 interacting protein 2
    • ADP ribosylation factor like protein 6 interacting protein 2
    • ADP-ribosylation factor-like protein 6-interacting protein 2
    • Aip 2
    • Aip-2
    • Aip2
    • ARL 6 interacting protein 2
    • ARL-6-interacting protein 2
    • ARL3IP2
    • ARL6IP 2
    • ATL 2
    • ATL2
    • ATLA2_HUMAN
    • Atlastin 2
    • Atlastin GTPase 2
    • Atlastin-2
    • Atlastin2
    • FLJ23293
    see all
  • Function
    GTPase tethering membranes through formation of trans-homooligomer and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis.
  • Tissue specificity
    Expressed in peripheral tissues (at protein level).
  • Sequence similarities
    Belongs to the GBP family. Atlastin subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab163808 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up