Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMI PTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAAD QEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLS AIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
    • Amino acids
      1 to 186
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosylation factor like 10B
    • ADP ribosylation factor like 8A
    • ADP ribosylation factor like protein 10B
    • ADP ribosylation factor like protein 8A
    • ARL 10B
    • ARL 8A
    • ARL10B
    • ARL8A
    • FLJ45195
    • GIE 2
    • GIE2
    • novel small G protein indispensable for equal chromosome segregation 2
    • OTTHUMP00000034102
    • Small G protein indispensable for equal chromosome segregation 2
    see all
  • Relevance
    ADP ribosylation factor like 8A belongs to the small GTPase superfamily. and may play a role in lysosomes motility. Alternatively, it may play a role in chromosome segregation.
  • Cellular localization
    Late endosome membrane. Lysosome membrane.

Images

  • ab165288 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up