Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMLRPGDCEVCISYLGRFYQDLKDRDV TFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHH IPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGE TCKGCAEKSDYIRKINELMPKYAPKAASARTDL
    • Molecular weight
      21 kDa including tags
    • Amino acids
      25 to 182
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Arginine rich mutated in early stage tumors
    • Arginine rich protein
    • Arginine-rich protein
    • ARMET
    • ARMET protein
    • ARP
    • Manf
    • MANF_HUMAN
    • Mesencephalic astrocyte derived neurotrophic factor
    • Mesencephalic astrocyte-derived neurotrophic factor
    • MGC142148
    • MGC142150
    • Protein ARMET
    see all
  • Function
    Selectively promotes the survival of dopaminergic neurons of the ventral mid-brain. Modulates GABAergic transmission to the dopaminergic neurons of the substantia nigra. Enhances spontaneous, as well as evoked, GABAergic inhibitory postsynaptic currents in dopaminergic neurons (By similarity). Inhibits cell proliferation and endoplasmic reticulum (ER) stress-induced cell death.
  • Sequence similarities
    Belongs to the ARMET family.
  • Domain
    The N-terminal region may be responsible for neurotrophic activity while the C-terminal region may play a role in the ER stress response.
  • Post-translational
    modifications
    May contain sialic acid residues.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human ARMET protein images

  • 15% SDS-PAGE analysis of 3 µg of ARMET protein (ab124557).

References for Recombinant Human ARMET protein (ab124557)

ab124557 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up