Recombinant Human Aromatase protein (ab112277)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGP GYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIIS KS SSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRP FFMK ALSGPGLVRMVTVCAESLKTHLLLFTPASVN
    • Molecular weight
      46 kDa
    • Amino acids
      1 to 182
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

    ELISA

    Western blot

    Peptide Array

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Reduced Glutathione

General Info

  • Alternative names
    • ARO
    • ARO1
    • Aromatase
    • CP19A_HUMAN
    • CPV1
    • CYAR
    • CYP19
    • Cyp19a1
    • CYPXIX
    • Cytochrome P-450AROM
    • Cytochrome P450 19A1
    • Cytochrome P450, family 19, subfamily A, polypeptide 1
    • Cytochrome P450, subfamily XIX (aromatization of androgens)
    • Estrogen synthase
    • Estrogen synthetase
    • Flavoprotein linked monooxygenase
    • MGC104309
    • Microsomal monooxygenase
    • OTTHUMP00000162543
    • OTTHUMP00000198350
    • P 450AROM
    see all
  • Function
    Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
  • Tissue specificity
    Brain, placenta and gonads.
  • Involvement in disease
    Defects in CYP19A1 are a cause of aromatase excess syndrome (AEXS) [MIM:139300]; also known as familial gynecomastia. AEXS is characterized by an estrogen excess due to an increased aromatase activity.
    Defects in CYP19A1 are the cause of aromatase deficiency (AROD) [MIM:107910]. AROD is a rare disease in which fetal androgens are not converted into estrogens due to placental aromatase deficiency. Thus, pregnant women exhibit a hirsutism, which spontaneously resolves after post-partum. At birth, female babies present with pseudohermaphroditism due to virilization of extern genital organs. In adult females, manifestations include delay of puberty, breast hypoplasia and primary amenorrhoea with multicystic ovaries.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human Aromatase protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue with recombinant protein.

References for Recombinant Human Aromatase protein (ab112277)

ab112277 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up