Recombinant Human Aromatase protein (ab114260)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGP GYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS SSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMK ALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSN TLFLRIPLDGTEIFTLTS
    • Molecular weight
      50 kDa including tags
    • Amino acids
      1 to 219

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARO
    • ARO1
    • Aromatase
    • CP19A_HUMAN
    • CPV1
    • CYAR
    • CYP19
    • Cyp19a1
    • CYPXIX
    • Cytochrome P-450AROM
    • Cytochrome P450 19A1
    • Cytochrome P450, family 19, subfamily A, polypeptide 1
    • Cytochrome P450, subfamily XIX (aromatization of androgens)
    • Estrogen synthase
    • Estrogen synthetase
    • Flavoprotein linked monooxygenase
    • MGC104309
    • Microsomal monooxygenase
    • OTTHUMP00000162543
    • OTTHUMP00000198350
    • P 450AROM
    see all
  • Function
    Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
  • Tissue specificity
    Brain, placenta and gonads.
  • Involvement in disease
    Defects in CYP19A1 are a cause of aromatase excess syndrome (AEXS) [MIM:139300]; also known as familial gynecomastia. AEXS is characterized by an estrogen excess due to an increased aromatase activity.
    Defects in CYP19A1 are the cause of aromatase deficiency (AROD) [MIM:107910]. AROD is a rare disease in which fetal androgens are not converted into estrogens due to placental aromatase deficiency. Thus, pregnant women exhibit a hirsutism, which spontaneously resolves after post-partum. At birth, female babies present with pseudohermaphroditism due to virilization of extern genital organs. In adult females, manifestations include delay of puberty, breast hypoplasia and primary amenorrhoea with multicystic ovaries.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human Aromatase protein images

  • ab114260 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Aromatase protein (ab114260)

ab114260 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up