Recombinant Human Aromatase protein (ab152321)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLII SKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPF FMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLD TSNTLFLRIPLDGTEIFTLTS
    • Molecular weight
      45 kDa including tags
    • Amino acids
      48 to 218

Specifications

Our Abpromise guarantee covers the use of ab152321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARO
    • ARO1
    • Aromatase
    • CP19A_HUMAN
    • CPV1
    • CYAR
    • CYP19
    • Cyp19a1
    • CYPXIX
    • Cytochrome P-450AROM
    • Cytochrome P450 19A1
    • Cytochrome P450, family 19, subfamily A, polypeptide 1
    • Cytochrome P450, subfamily XIX (aromatization of androgens)
    • Estrogen synthase
    • Estrogen synthetase
    • Flavoprotein linked monooxygenase
    • MGC104309
    • Microsomal monooxygenase
    • OTTHUMP00000162543
    • OTTHUMP00000198350
    • P 450AROM
    see all
  • Function
    Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
  • Tissue specificity
    Brain, placenta and gonads.
  • Involvement in disease
    Defects in CYP19A1 are a cause of aromatase excess syndrome (AEXS) [MIM:139300]; also known as familial gynecomastia. AEXS is characterized by an estrogen excess due to an increased aromatase activity.
    Defects in CYP19A1 are the cause of aromatase deficiency (AROD) [MIM:107910]. AROD is a rare disease in which fetal androgens are not converted into estrogens due to placental aromatase deficiency. Thus, pregnant women exhibit a hirsutism, which spontaneously resolves after post-partum. At birth, female babies present with pseudohermaphroditism due to virilization of extern genital organs. In adult females, manifestations include delay of puberty, breast hypoplasia and primary amenorrhoea with multicystic ovaries.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152321 stained with Coomassie Blue.

References

ab152321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up