Overview

  • Product name
    Recombinant Human ARP10 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENK KKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHD HLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVD HEKPLSFNPYKMLEELDKNSRAIKRRLERIKS
    • Amino acids
      1 to 182
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A3H
    • APOBEC related protein 10
    • APOBEC3H
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3H
    • ARP 10
    • DNA dC->dU-editing enzyme APOBEC-3H
    see all
  • Relevance
    ARP10 belongs to the cytidine and deoxycytidylate deaminase family. It is a poorly expressed deaminase that is ineffective at inhibiting retroviral replication. ARP10 has DNA deaminase (cytidine deaminase) activity but is not able to mediate G-to-A hypermutation in newly synthesized retroviral DNA. It is present at low level in 293T cells. It is considered an unstable protein, suggesting that it may be degraded by the proteasome (at protein level). Weakly expressed in testis, ovary, fetal liver and skin. There are two named isoforms. ARP10 from old world monkeys has retained its antiviral activity, while it is lost in other primates. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22.
  • Cellular localization
    Nucleus. Cytoplasm. Note: Mostly nuclear.

Images

  • ab165769 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up