Overview

  • Product nameRecombinant Human Arp2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP61160
    • SpeciesHuman
    • SequenceMDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNI EIKDLMVGDEASELRSTLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNI DTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQG LLTGVVVDSGDGVTHICPVYESFSLPHLTRRLDIAGRDITRYLIKLLLLR GYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGR IIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR KHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
    • Molecular weight69 kDa
    • Amino acids1 to 394

Specifications

Our Abpromise guarantee covers the use of ab112388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Other

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Actin like protein 2
    • Actin related protein 2
    • Actin-like protein 2
    • Actin-related protein 2
    • ACTR2
    • ARP2
    • ARP2 actin related protein 2 homolog (yeast)
    • ARP2/3 COMPLEX
    • ARP2_HUMAN
    • OTTHUMP00000159937
    • OTTHUMP00000202270
    see all
  • FunctionFunctions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament.
  • Sequence similaritiesBelongs to the actin family. ARP2 subfamily.
  • Cellular localizationCytoplasm > cytoskeleton. Cell projection.
  • Information by UniProt

Recombinant Human Arp2 protein images

  • 12.5% SDS-PAGE analysis of ab112388. Stained with Coomassie Blue.

References for Recombinant Human Arp2 protein (ab112388)

ab112388 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"