Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNI EIKDLMVGDEASELRSTLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNI DTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQG LLTGVVVDSGDGVTHICPVYESFSLPHLTRRLDIAGRDITRYLIKLLLLR GYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGR IIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR KHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
    • Molecular weight
      69 kDa
    • Amino acids
      1 to 394

Specifications

Our Abpromise guarantee covers the use of ab112388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Other

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Actin like protein 2
    • Actin related protein 2
    • Actin-like protein 2
    • Actin-related protein 2
    • ACTR2
    • ARP2
    • ARP2 actin related protein 2 homolog (yeast)
    • ARP2/3 COMPLEX
    • ARP2_HUMAN
    • OTTHUMP00000159937
    • OTTHUMP00000202270
    see all
  • Function
    Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament.
  • Sequence similarities
    Belongs to the actin family. ARP2 subfamily.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab112388. Stained with Coomassie Blue.

References

ab112388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up