Recombinant Human Arp3 protein (denatured) (ab187418)

Overview

  • Product name
    Recombinant Human Arp3 protein (denatured)
  • Protein length
    Full length protein
  • Description
    Recombinant Human Arp3 protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAGRLPACVVDCGTGYTKLGYAGNTEP QFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWP IRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTA EIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHV IPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAV KERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFL GPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTM FRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAV WFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
    • Molecular weight
      50 kDa including tags
    • Amino acids
      1 to 418
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab187418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • Actin like protein 3
    • Actin related protein 3
    • ACTR3
    • ARP3 actin related protein 3 homolog (yeast)
  • Relevance
    The Arp2/3 complex involved in Golgi polerization in NIH3T3 cells. In a different model it has been shown that the Arp2/3 complex is necessary for neutrophil chemotaxis and phagocytosis.
  • Cellular localization
    Cytoplasmic

Images

  • 15% SDS-PAGE analysis of 3 µg ab187418.

References

ab187418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up