Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQP VTISRNEKEKVLIEGSINSVRVSIAVKQADEIEKILCHKFMRFTMMRAEN FFILRRKPVE
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Actin related protein 2/3 complex subunit 4
    • Actin related protein 2/3 complex subunit 4 20 kD
    • Actin related protein 2/3 complex subunit 4 20kDa
    • Actin related protein 2/3 complex, 20-KD subunit
    • Actin-related protein 2/3 complex subunit 4
    • ARC20
    • Arp2/3 complex 20 kDa subunit
    • Arp2/3 protein complex subunit p20
    • ARPC 4
    • ARPC4
    • ARPC4_HUMAN
    • MGC13544
    • OTTHUMP00000165252
    • OTTHUMP00000207520
    • p20 Arc
    • p20-ARC
    • p20ARC
    see all
  • Function
    Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament.
  • Sequence similarities
    Belongs to the ARPC4 family.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection.
  • Information by UniProt

Images

  • ab160809 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up