Recombinant Human Arrestin C protein (ab116770)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLF VMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQER LLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAEN PEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWM DREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTV FIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS TIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIH PKPSYEAAR
    • Molecular weight
      66 kDa including tags
    • Amino acids
      1 to 359

Specifications

Our Abpromise guarantee covers the use of ab116770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARR3
    • ARR4
    • ARRC_HUMAN
    • Arrestin 3 retinal
    • Arrestin 3 retinal (X-arrestin)
    • Arrestin 4
    • Arrestin-C
    • ARRX
    • C arrestin
    • C-arrestin
    • CAR
    • cArr
    • Cone arrestin
    • Retinal cone arrestin 3
    • Retinal cone arrestin-3
    • X arrestin
    • X-arrestin
    see all
  • Function
    May play a role in an as yet undefined retina-specific signal transduction. Could binds to photoactivated-phosphorylated red/green opsins.
  • Tissue specificity
    Inner and outer segments, and the inner plexiform regions of the retina.
  • Sequence similarities
    Belongs to the arrestin family.
  • Information by UniProt

Recombinant Human Arrestin C protein images

  • 12.5% SDS-PAGE showing ab116770 at approximately 65.60kDa stained with Coomassie Blue.

References for Recombinant Human Arrestin C protein (ab116770)

ab116770 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up