Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVN RDLTRRVRNINGITQHKQIVRNDIKLAAKLIHTLDDRTQLWASEPGTPPL PTSLPSQNPILKNITDYLIEEVSAEEEELLGSSGGAPPEEPPKEGNPAEI NVERDEKLIKVLDKLLLYLRIVHSLDYYNTCEYPNEDEMPNRCGIIHVRG PMPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQEV EKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEV AFFNNFLTDAKRPALPEIKPAQPPGPAQILPPGLTPGLPYPHQTPQGLMP YGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFRGQGGYPG KPRNRMVRGDPRAIVEYRDLDAPDDVDFF
    • Amino acids
      1 to 429
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162602 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARS2 protein
    • Arsenate resistance protein ARS2
    • Arsenite resistance protein
    • Arsenite resistance protein 2
    • Arsenite-resistance protein 2
    • ASR2
    • MGC126427
    • Serrate
    • Serrate RNA effector molecule
    • Serrate RNA effector molecule homolog
    • Serrate RNA effector molecule homolog (Arabidopsis)
    • SRRT
    • SRRT_HUMAN
    see all
  • Function
    Acts as a mediator between the cap-binding complex (CBC) and the primary microRNAs (miRNAs) processing machinery during cell proliferation. Contributes to the stability and delivery of capped primary miRNA transcripts to the primary miRNA processing complex containing DGCR8 and DROSHA, thereby playing a role in RNA-mediated gene silencing (RNAi) by miRNAs. Binds capped RNAs (m7GpppG-capped RNA); however interaction is probably mediated via its interaction with NCBP1/CBP80 component of the CBC complex. Involved in cell cycle progression at S phase. Does not directly confer arsenite resistance but rather modulates arsenic sensitivity.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the ARS2 family.
  • Cellular localization
    Nucleus > nucleoplasm. Cytoplasm. Predominantly nuclear. Shuttles between the nucleus and the cytoplasm in a CRM1-dependent way.
  • Information by UniProt

Images

  • ab162602 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162602 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162602.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up