Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SFDDQYQGCSKQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKV LPQNMTTTHAVAILFYTLNSNVHSDFTRAMASVARTPQQYERSFHFKYLH
    • Amino acids
      61 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADP ribosyltransferase 4
    • ADP ribosyltransferase 4 (DO blood group)
    • ADP ribosyltransferase 4 (Dombrock blood group)
    • ART 4
    • CD297
    • CD297 antigen
    • DO
    • DOK1
    • Dombrock blood group carrier molecule
    • Ecto ADP ribosyltransferase 4
    • Mono ADP ribosyltransferase 4
    • Mono(ADP ribosyl)transferase 4
    • NAD(P)(+) arginine ADP ribosyltransferase 4
    see all
  • Relevance
    ART4 is a member of the ADP ribosyltransferase gene family. Antigens of the Dombrock blood group system are located on the gene product, which is glycosylphosphatidylinosotol anchored to the erythrocyte membrane. Allelic variants, some of which lead to adverse transfusion reactions, are known.
  • Cellular localization
    Cell membrane; Lipidbanchor, GPI anchor.

Images

  • ab157916 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up