Recombinant Human Aryl hydrocarbon Receptor protein (ab112247)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP35869
    • SpeciesHuman
    • SequenceMGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVS MYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
    • Molecular weight37 kDa
    • Amino acids721 to 820
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ah receptor
    • AhR
    • AHR_HUMAN
    • Aromatic hydrocarbon receptor
    • Aryl hydrocarbon receptor
    • Aryl hydrocarbon receptor precursor
    • bHLHe76
    • Class E basic helix loop helix protein 76
    • Class E basic helix-loop-helix protein 76
    • HGNC:348
    see all
  • FunctionLigand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues.
  • Tissue specificityExpressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localizationCytoplasm. Nucleus. Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus.
  • Information by UniProt

Recombinant Human Aryl hydrocarbon Receptor protein images

  • 12.5% SDS page analysis of ab112247

References for Recombinant Human Aryl hydrocarbon Receptor protein (ab112247)

ab112247 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"