Recombinant Human Aryl hydrocarbon Receptor protein (ab112247)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVS MYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
    • Molecular weight
      37 kDa
    • Amino acids
      721 to 820
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ah receptor
    • AhR
    • AHR_HUMAN
    • Aromatic hydrocarbon receptor
    • Aryl hydrocarbon receptor
    • Aryl hydrocarbon receptor precursor
    • bHLHe76
    • Class E basic helix loop helix protein 76
    • Class E basic helix-loop-helix protein 76
    • HGNC:348
    see all
  • Function
    Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues.
  • Tissue specificity
    Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localization
    Cytoplasm. Nucleus. Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS page analysis of ab112247

References

ab112247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up