Recombinant Human ASAH1 protein (ab114948)
Key features and details
- Expression system: Wheat germ
- Suitable for: ELISA, SDS-PAGE, WB
Description
-
Product name
Recombinant Human ASAH1 protein
See all ASAH1 proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLK VIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD -
Predicted molecular weight
37 kDa including tags -
Amino acids
25 to 124
-
Specifications
Our Abpromise guarantee covers the use of ab114948 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
Western blot
-
Form
Liquid -
Additional notes
Protein concentration is above or equal to 0.05 mg/ml.
Best used within three months from the date of receipt. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- AC
- ACDase
- Acid CDase
see all -
Function
Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid. -
Tissue specificity
Broadly expressed with highest expression in heart. -
Involvement in disease
Defects in ASAH1 are the cause of Farber lipogranulomatosis (FL) [MIM:228000]; also known as Farber disease (FD). This sphingolipid disease is characterized by subcutaneous lipid-loaded nodules, excruciating pain in the joints and extremities, marked accumulation of ceramide in lysosomes, and death by three years of age. -
Sequence similarities
Belongs to the acid ceramidase family. -
Cellular localization
Lysosome. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab114948 has not yet been referenced specifically in any publications.